Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACBD5 Rabbit Polyclonal Antibody (FITC)

ACBD5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RDLKD

UniProt

Q5T8D3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ACBD5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035938

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMBX1 (Diencephalon/Mesencephalon Homeobox Protein 1, Orthodenticle Homolog 3, Paired-like Homeobox Protein DMBX1, MBX, OTX3, PAXB) (MaxLight 750)
MBS6232520-01 0.1 mL

DMBX1 (Diencephalon/Mesencephalon Homeobox Protein 1, Orthodenticle Homolog 3, Paired-like Homeobox Protein DMBX1, MBX, OTX3, PAXB) (MaxLight 750)

Sign In for Pricing
View Details
DMBX1 (Diencephalon/Mesencephalon Homeobox Protein 1, Orthodenticle Homolog 3, Paired-like Homeobox Protein DMBX1, MBX, OTX3, PAXB) (MaxLight 750)
MBS6232520-02 5x 0.1 mL

DMBX1 (Diencephalon/Mesencephalon Homeobox Protein 1, Orthodenticle Homolog 3, Paired-like Homeobox Protein DMBX1, MBX, OTX3, PAXB) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit P-Selectin (P-Sel) ELISA kit
MBS2600702-01 48 Well

Rabbit P-Selectin (P-Sel) ELISA kit

Sign In for Pricing
View Details
Rabbit P-Selectin (P-Sel) ELISA kit
MBS2600702-02 96 Well

Rabbit P-Selectin (P-Sel) ELISA kit

Sign In for Pricing
View Details
Rabbit P-Selectin (P-Sel) ELISA kit
MBS2600702-03 5x 96 Well

Rabbit P-Selectin (P-Sel) ELISA kit

Sign In for Pricing
View Details
Rabbit P-Selectin (P-Sel) ELISA kit
MBS2600702-04 10x 96 Well

Rabbit P-Selectin (P-Sel) ELISA kit

Sign In for Pricing
View Details