Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRBP1 Rabbit Polyclonal Antibody (HRP)

RRBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RRp, hES, p180, ES130, ES/130

UniProt

Q9P2E9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RRBP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TDVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001036041

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin Phosphatase (PPP1R12A) (NM_001143885) Human Over-expression Lysate
LC428392 20 µg

Myosin Phosphatase (PPP1R12A) (NM_001143885) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Dengue virus DENV-2 (Strain New Guinea C/PUO-218 hybrid) E/Envelope Protein (Domain III) Monoclonal Antibody
E-AB-V1072-01 20 µL

Anti-Dengue virus DENV-2 (Strain New Guinea C/PUO-218 hybrid) E/Envelope Protein (Domain III) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Dengue virus DENV-2 (Strain New Guinea C/PUO-218 hybrid) E/Envelope Protein (Domain III) Monoclonal Antibody
E-AB-V1072-02 100 µL

Anti-Dengue virus DENV-2 (Strain New Guinea C/PUO-218 hybrid) E/Envelope Protein (Domain III) Monoclonal Antibody

Sign In for Pricing
View Details
TBL1Y (NM_033284) Human Recombinant Protein
TP320139L 1 mg

TBL1Y (NM_033284) Human Recombinant Protein

Sign In for Pricing
View Details
CCN1 (CYR61) Human Gene Knockout Kit (CRISPR)
KN203492BN 1 Kit

CCN1 (CYR61) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Uterus
CS644133 5x 5 µm

Frozen Tissue Sections, Uterus

Sign In for Pricing
View Details