Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM91 Rabbit Polyclonal Antibody (Biotin)

TMEM91 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DSPC3, IFITMD6

UniProt

Q6P434

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM91

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001036060

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOQ (TC10, ARHQ, RASL7A, Rho-related GTP-binding Protein RhoQ, Ras-like Protein TC10, Ras-like Protein Family Member 7A) (MaxLight 405) discontinued
132565-ML405 100 µL

RHOQ (TC10, ARHQ, RASL7A, Rho-related GTP-binding Protein RhoQ, Ras-like Protein TC10, Ras-like Protein Family Member 7A) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Guinea pig NPYR1 (Neuropeptide Y Receptor Y1) ELISA Kit
MBS2512619-01 24 Tests

Guinea pig NPYR1 (Neuropeptide Y Receptor Y1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig NPYR1 (Neuropeptide Y Receptor Y1) ELISA Kit
MBS2512619-02 48 Tests

Guinea pig NPYR1 (Neuropeptide Y Receptor Y1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig NPYR1 (Neuropeptide Y Receptor Y1) ELISA Kit
MBS2512619-03 96 Tests

Guinea pig NPYR1 (Neuropeptide Y Receptor Y1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig NPYR1 (Neuropeptide Y Receptor Y1) ELISA Kit
MBS2512619-04 5x 96 Tests

Guinea pig NPYR1 (Neuropeptide Y Receptor Y1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig NPYR1 (Neuropeptide Y Receptor Y1) ELISA Kit
MBS2512619-05 10x 96 Tests

Guinea pig NPYR1 (Neuropeptide Y Receptor Y1) ELISA Kit

Sign In for Pricing
View Details