Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLCC1 Rabbit Polyclonal Antibody (FITC)

CLCC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MCLC, RP32

UniProt

Q96S66

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLCC1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLPDENKGD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001041675

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELOVL5, CT (ELOVL5, ELOVL2, Elongation of very long chain fatty acids protein 5, 3-keto acyl-CoA synthase ELOVL5, ELOVL fatty acid elongase 5, Fatty acid elongase 1) (APC)
MBS6295403-01 0.2 mL

ELOVL5, CT (ELOVL5, ELOVL2, Elongation of very long chain fatty acids protein 5, 3-keto acyl-CoA synthase ELOVL5, ELOVL fatty acid elongase 5, Fatty acid elongase 1) (APC)

Sign In for Pricing
View Details
ELOVL5, CT (ELOVL5, ELOVL2, Elongation of very long chain fatty acids protein 5, 3-keto acyl-CoA synthase ELOVL5, ELOVL fatty acid elongase 5, Fatty acid elongase 1) (APC)
MBS6295403-02 5x 0.2 mL

ELOVL5, CT (ELOVL5, ELOVL2, Elongation of very long chain fatty acids protein 5, 3-keto acyl-CoA synthase ELOVL5, ELOVL fatty acid elongase 5, Fatty acid elongase 1) (APC)

Sign In for Pricing
View Details
Rat Desmin (Des) ELISA Kit
orb1948851-01 48 Tests

Rat Desmin (Des) ELISA Kit

Sign In for Pricing
View Details
Rat Desmin (Des) ELISA Kit
orb1948851-02 96 Tests

Rat Desmin (Des) ELISA Kit

Sign In for Pricing
View Details
Human Golgi Protein 73 (GP-73) ELISA Kit
orb1949049-01 48 Tests

Human Golgi Protein 73 (GP-73) ELISA Kit

Sign In for Pricing
View Details
Human Golgi Protein 73 (GP-73) ELISA Kit
orb1949049-02 96 Tests

Human Golgi Protein 73 (GP-73) ELISA Kit

Sign In for Pricing
View Details