Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Creld1 Rabbit Polyclonal Antibody (HRP)

Creld1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

I11E7, AI843811

UniProt

Q91XD7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Creld1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ACGQCGLGYFEAERNSSHLVCSACFGPCARCTGPEESHCLQCKKGWALHH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_598691

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CryoCube F570hw ULT -80C Freezer 570L w/ Chart Recorder and LN2 Back-Up System
FRE6236 1 Each

CryoCube F570hw ULT -80C Freezer 570L w/ Chart Recorder and LN2 Back-Up System

Sign In for Pricing
View Details
MCM8 (C20orf154, DNA Helicase MCM8, Minichromosome Maintenance 8, MGC119522, MGC119523, MGC12866, MGC4816, REC, DJ967N21.5) (AP)
MBS6132258-01 0.1 mL

MCM8 (C20orf154, DNA Helicase MCM8, Minichromosome Maintenance 8, MGC119522, MGC119523, MGC12866, MGC4816, REC, DJ967N21.5) (AP)

Sign In for Pricing
View Details
MCM8 (C20orf154, DNA Helicase MCM8, Minichromosome Maintenance 8, MGC119522, MGC119523, MGC12866, MGC4816, REC, DJ967N21.5) (AP)
MBS6132258-02 5x 0.1 mL

MCM8 (C20orf154, DNA Helicase MCM8, Minichromosome Maintenance 8, MGC119522, MGC119523, MGC12866, MGC4816, REC, DJ967N21.5) (AP)

Sign In for Pricing
View Details
PELI3 antibody - N-terminal region
MBS3211724-01 0.1 mL

PELI3 antibody - N-terminal region

Sign In for Pricing
View Details
PELI3 antibody - N-terminal region
MBS3211724-02 5x 0.1 mL

PELI3 antibody - N-terminal region

Sign In for Pricing
View Details
Anti-DNAJB14 Antibody Picoband® Fluoro647 Conjugated
A12429-1-Fluoro647 100 µg/Vial

Anti-DNAJB14 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details