Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ22167 Rabbit Polyclonal Antibody (HRP)

FLJ22167 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MKS11, JBTS20, ALYE870, PRO1886

UniProt

Q9H6L2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ22167

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001070886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF405S conjugate, 0.1mg/mL
BNC041868-100 1x 100 µL

Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human AKR1B1 Protein (His Tag)
PKSH031165 100 µg

Recombinant Human AKR1B1 Protein (His Tag)

Sign In for Pricing
View Details
EIF4E Mouse Monoclonal Antibody [Clone ID: 5D11]
AM06602SU-N 100 µL

EIF4E Mouse Monoclonal Antibody [Clone ID: 5D11]

Sign In for Pricing
View Details
GABA B Receptor 1 Recombinant Rabbit monoclonal Antibody
HA722653 100 µL

GABA B Receptor 1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G3]
TA504035BM 100 µL

Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G3]

Sign In for Pricing
View Details
H4c9 (NM_175656) Mouse Tagged ORF Clone
MG200342 10 µg

H4c9 (NM_175656) Mouse Tagged ORF Clone

Sign In for Pricing
View Details