Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD81, Human (HEK293, Fc)

The CD19 receptor is critical for B cell activation, driving the trafficking and assembly of CD19-CR2 and BCR complexes, thereby lowering the antigenic threshold for B cell clonal expansion. In T cells, CD19 contributes to CD3 localization and influences polarization. CD81 Protein, Human (HEK293, Fc) is the recombinant human-derived CD81 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CD81 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd81-protein-human-hek-293-fc.html

Purity

98.0

Smiles

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Molecular Formula

975 (Gene_ID) P60033 (F113-K201) (Accession)

Molecular Weight

Approximately 37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Boydii plsY Protein (aa 1-205)
VAng-Lsx08757-inquire Inquire

Recombinant Shigella Boydii plsY Protein (aa 1-205)

Sign In for Pricing
View Details
Lentiviral mouse Defa3 shRNA (UAS) - Lentiviral mouse Defa3 shRNA (UAS, iRFP) (100)
GTR15156063 1 Vial

Lentiviral mouse Defa3 shRNA (UAS) - Lentiviral mouse Defa3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CIB Double Nickase Plasmid (h)
sc-405501-NIC 20 µg

CIB Double Nickase Plasmid (h)

Sign In for Pricing
View Details
E2F6 Rabbit mAb
E45R12536N-100 100 µL

E2F6 Rabbit mAb

Sign In for Pricing
View Details
STK39 Adenovirus (Human)
45751051 1.0 mL

STK39 Adenovirus (Human)

Sign In for Pricing
View Details
Pneumadin
orb372720-01 1 mg

Pneumadin

Sign In for Pricing
View Details