Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMTC4 Rabbit Polyclonal Antibody (FITC)

TMTC4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ14624, FLJ22153

UniProt

Q5T4D3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMTC4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_116202

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wheat Germ Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG11F-WG/W 10x 96 Well Plates

Wheat Germ Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details
Ɑ-Butyric Acid NHS Ester-ω-Biotinamido PEG
135000-25-35.1G 1 g

Ɑ-Butyric Acid NHS Ester-ω-Biotinamido PEG

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF640R conjugate, 0.1mg/mL
BNC401869-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v3 (Marker of Tumor Metastasis) (3G5), Biotin conjugate, 0.1mg/mL
BNCB2429-100 1x 100 µL

CD44v3 (Marker of Tumor Metastasis) (3G5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eg5 (KIF11) (NM_004523) Human Recombinant Protein
TP318842M 100 µg

Eg5 (KIF11) (NM_004523) Human Recombinant Protein

Sign In for Pricing
View Details
PAK5 Human Gene Knockout Kit (CRISPR)
KN205255LP 1 Kit

PAK5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details