Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMTC4 Rabbit Polyclonal Antibody (HRP)

TMTC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ14624, FLJ22153

UniProt

Q5T4D3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMTC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_116202

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,5-Dichloro-2- (3,5-dichlorophenyl) -3 (2H) -pyridazinone
sc-507167 1 g

4,5-Dichloro-2- (3,5-dichlorophenyl) -3 (2H) -pyridazinone

Sign In for Pricing
View Details
APOBEC2 siRNA (Mouse)
CRM0219-01 15 nmol

APOBEC2 siRNA (Mouse)

Sign In for Pricing
View Details
APOBEC2 siRNA (Mouse)
CRM0219-02 30 nmol

APOBEC2 siRNA (Mouse)

Sign In for Pricing
View Details
ZNRD1 (DNA-directed RNA Polymerase I Subunit RPA12, Zinc Ribbon Domain-containing Protein 1, RPA12, MGC13376) (MaxLight 650)
MBS6399313-01 0.1 mL

ZNRD1 (DNA-directed RNA Polymerase I Subunit RPA12, Zinc Ribbon Domain-containing Protein 1, RPA12, MGC13376) (MaxLight 650)

Sign In for Pricing
View Details
ZNRD1 (DNA-directed RNA Polymerase I Subunit RPA12, Zinc Ribbon Domain-containing Protein 1, RPA12, MGC13376) (MaxLight 650)
MBS6399313-02 5x 0.1 mL

ZNRD1 (DNA-directed RNA Polymerase I Subunit RPA12, Zinc Ribbon Domain-containing Protein 1, RPA12, MGC13376) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Polyclonal PELP1 Antibody [Alexa Fluor 405]
NB200-331AF405 0.1 mL

Rabbit Polyclonal PELP1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details