Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMTC4 Rabbit Polyclonal Antibody (HRP)

TMTC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ14624, FLJ22153

UniProt

Q5T4D3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMTC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_116202

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGR3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
19047151 3x 1.0 µg DNA

EGR3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
YJEFN3 (NM_198537) Human Tagged ORF Clone Lentiviral Particle
RC222733L4V 200 µL

YJEFN3 (NM_198537) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
STOM Antibody - C-terminal region
ARP61408_P050-25UL 25 µL

STOM Antibody - C-terminal region

Sign In for Pricing
View Details
Uncoated Rat HPX (Hemopexin) ELISA Kit
E-UNEL-R0047-01 5x 96 Tests

Uncoated Rat HPX (Hemopexin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat HPX (Hemopexin) ELISA Kit
E-UNEL-R0047-02 15x 96 Tests

Uncoated Rat HPX (Hemopexin) ELISA Kit

Sign In for Pricing
View Details
Anti-CD79a Monoclonal Antibody (Clone:HM57) -FITC Conjugated
30-2028-100 100 Tests

Anti-CD79a Monoclonal Antibody (Clone:HM57) -FITC Conjugated

Sign In for Pricing
View Details