Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMTC4 Rabbit Polyclonal Antibody (HRP)

TMTC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ14624, FLJ22153

UniProt

Q5T4D3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TMTC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001073137

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H5]
TA801325AM 100 µL

ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H5]

Sign In for Pricing
View Details
DR1 (NM_001938) Human Recombinant Protein
TP305733 20 µg

DR1 (NM_001938) Human Recombinant Protein

Sign In for Pricing
View Details
NF-kB p105 / p50 Recombinant Rabbit monoclonal Antibody
HA750060 100 µL

NF-kB p105 / p50 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TTC23 (NM_001040656) Human Over-expression Lysate
LY421797 100 µg

TTC23 (NM_001040656) Human Over-expression Lysate

Sign In for Pricing
View Details
Cabotegravir O-Beta-D-Glucuronide
TRC-C050105-5MG 5 mg

Cabotegravir O-Beta-D-Glucuronide

Sign In for Pricing
View Details
IZUMO4 Human qPCR Primer Pair (NM_001039846)
HP234452 200 Reactions

IZUMO4 Human qPCR Primer Pair (NM_001039846)

Sign In for Pricing
View Details