Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AADAC Rabbit Polyclonal Antibody (Biotin)

AADAC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DAC, CES5A1

UniProt

P22760

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human AADAC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001077

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cysteinyl Aspartate Specific Proteinases 3 (Caspase-3) ELISA Kit
MBS9390242-01 48 Well

Human Cysteinyl Aspartate Specific Proteinases 3 (Caspase-3) ELISA Kit

Sign In for Pricing
View Details
Human Cysteinyl Aspartate Specific Proteinases 3 (Caspase-3) ELISA Kit
MBS9390242-02 96 Well

Human Cysteinyl Aspartate Specific Proteinases 3 (Caspase-3) ELISA Kit

Sign In for Pricing
View Details
Human Cysteinyl Aspartate Specific Proteinases 3 (Caspase-3) ELISA Kit
MBS9390242-03 5x 96 Well

Human Cysteinyl Aspartate Specific Proteinases 3 (Caspase-3) ELISA Kit

Sign In for Pricing
View Details
Human Cysteinyl Aspartate Specific Proteinases 3 (Caspase-3) ELISA Kit
MBS9390242-04 10x 96 Well

Human Cysteinyl Aspartate Specific Proteinases 3 (Caspase-3) ELISA Kit

Sign In for Pricing
View Details
PPP2R5D (Serine/Threonine-Protein Phosphatase 2A 65kD Regulatory Subunit A delta Isoform, PP2A B Subunit Isoform B'-delta, PP2A B Subunit Isoform B56-delta, PP2A B Subunit Isoform PR61-delta, PP2A B Subunit Isoform R5-delta, MGC2134, MGC8949) (MaxLight 405) discontinued
131723-ML405 100 µL

PPP2R5D (Serine/Threonine-Protein Phosphatase 2A 65kD Regulatory Subunit A delta Isoform, PP2A B Subunit Isoform B'-delta, PP2A B Subunit Isoform B56-delta, PP2A B Subunit Isoform PR61-delta, PP2A B Subunit Isoform R5-delta, MGC2134, MGC8949) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human TAK1 (TAK1) ELISA Kit
YP-W17583-01 48 Tests

Human TAK1 (TAK1) ELISA Kit

Sign In for Pricing
View Details