Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2B Rabbit Polyclonal Antibody (HRP)

ACVR2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HTX4, ACTRIIB, ActR-IIB

UniProt

Q13705

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACVR2B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001097

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARNT2, ID (ARNT2, BHLHE1, KIAA0307, Aryl hydrocarbon receptor nuclear translocator 2, Class E basic helix-loop-helix protein 1) (PE)
MBS6275335-01 0.2 mL

ARNT2, ID (ARNT2, BHLHE1, KIAA0307, Aryl hydrocarbon receptor nuclear translocator 2, Class E basic helix-loop-helix protein 1) (PE)

Sign In for Pricing
View Details
ARNT2, ID (ARNT2, BHLHE1, KIAA0307, Aryl hydrocarbon receptor nuclear translocator 2, Class E basic helix-loop-helix protein 1) (PE)
MBS6275335-02 5x 0.2 mL

ARNT2, ID (ARNT2, BHLHE1, KIAA0307, Aryl hydrocarbon receptor nuclear translocator 2, Class E basic helix-loop-helix protein 1) (PE)

Sign In for Pricing
View Details
AP2M1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-11241R-BF647 100 µL

AP2M1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Phospho-p38 MAPK (Thr180 + Tyr182) Polyclonal Antibody
bs-2210R-TR 20 µL

Phospho-p38 MAPK (Thr180 + Tyr182) Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal CD117/c-kit Antibody (2B8) [Janelia Fluor 646]
NB100-77477JF646 0.1 mL

Rat Monoclonal CD117/c-kit Antibody (2B8) [Janelia Fluor 646]

Sign In for Pricing
View Details
Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone:6B8]
E45M18957 100 µg

Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone:6B8]

Sign In for Pricing
View Details