Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART3 Rabbit Polyclonal Antibody (Biotin)

ART3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARTC3

UniProt

Q13508

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ART3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHFYLTRALQLLRKPCEASS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001170

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LSG1 sgRNA gene knockout kit - Lentiviral human LSG1 sgRNA gene knockout kit (plasmid)
GTR15390218 1 Vial

Lentiviral human LSG1 sgRNA gene knockout kit - Lentiviral human LSG1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Slc5a2 3'UTR Luciferase Stable Cell Line
TU220701 1.0 mL

Slc5a2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit
MBS3807391-01 48 Well

Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit

Sign In for Pricing
View Details
Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit
MBS3807391-02 96 Well

Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit

Sign In for Pricing
View Details
Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit
MBS3807391-03 5x 96 Well

Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit

Sign In for Pricing
View Details
Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit
MBS3807391-04 10x 96 Well

Mouse Gamma-Aminobutyric Acid C Receptor (GABC) ELISA Kit

Sign In for Pricing
View Details