Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART3 Rabbit Polyclonal Antibody (HRP)

ART3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARTC3

UniProt

Q13508

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ART3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHFYLTRALQLLRKPCEASS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001170

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiagNano™ Human Serum IgA Gold Nanoparticles, 40 nm
HSACG-40 1 mL

DiagNano™ Human Serum IgA Gold Nanoparticles, 40 nm

Sign In for Pricing
View Details
Phospho-VEGF Receptor 2 (Tyr1175) Antibody [M10N15]
F4139-20uL 20 µL

Phospho-VEGF Receptor 2 (Tyr1175) Antibody [M10N15]

Sign In for Pricing
View Details
Rabbit Anti-GHITM Polyclonal Antibody
PAV7546 100 μL

Rabbit Anti-GHITM Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IGF-I (Previously QED Part No.: 20802P) - 100 μg
I-180-100 μg 100 µg

Recombinant Human IGF-I (Previously QED Part No.: 20802P) - 100 μg

Sign In for Pricing
View Details
Prp2 ORF Vector (Mouse) (pORF)
ORF054928 1.0 µg DNA

Prp2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rat Gamma-Aminobutyric Acid Receptor Subunit Epsilon (GABRE) ELISA Kit
MBS9914334-01 48 Well

Rat Gamma-Aminobutyric Acid Receptor Subunit Epsilon (GABRE) ELISA Kit

Sign In for Pricing
View Details