Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDS1 Rabbit Polyclonal Antibody (HRP)

CDS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDS 1

UniProt

Q92903

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001254

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100504959 3'UTR Luciferase Stable Cell Line
TU112209 1.0 mL

LOC100504959 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CHMP1A, NT (CHMP1A, CHMP1, KIAA0047, PCOLN3, PRSM1, Charged multivesicular body protein 1a, Chromatin-modifying protein 1a, Vacuolar protein sorting-associated protein 46-1) (MaxLight 490) discontinued
033850-ML490 100 µL

CHMP1A, NT (CHMP1A, CHMP1, KIAA0047, PCOLN3, PRSM1, Charged multivesicular body protein 1a, Chromatin-modifying protein 1a, Vacuolar protein sorting-associated protein 46-1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Chrna10 3'UTR Luciferase Stable Cell Line
TU202319 1.0 mL

Chrna10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DCTD (Deoxycytidylate Deaminase, dCMP Deaminase) (MaxLight 650)
MBS6375762-01 0.1 mL

DCTD (Deoxycytidylate Deaminase, dCMP Deaminase) (MaxLight 650)

Sign In for Pricing
View Details
DCTD (Deoxycytidylate Deaminase, dCMP Deaminase) (MaxLight 650)
MBS6375762-02 5x 0.1 mL

DCTD (Deoxycytidylate Deaminase, dCMP Deaminase) (MaxLight 650)

Sign In for Pricing
View Details
RSK1 p90 Antibody
DF7701-01 100 µL

RSK1 p90 Antibody

Sign In for Pricing
View Details