Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL10RA Rabbit Polyclonal Antibody (FITC)

IL10RA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CD210, IL10R, CD210a, CDW210A, HIL-10R, IL-10R1

UniProt

Q13651

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL10RA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_001549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE2A Protein Vector (Rat) (pPB-N-His)
PV293035 500 ng

PDE2A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Soluble Tumor Necrosis Factor-Related Apoptosis Inducing Ligand ELISA Kit
MBS045464-01 48 Well

Mouse Soluble Tumor Necrosis Factor-Related Apoptosis Inducing Ligand ELISA Kit

Sign In for Pricing
View Details
Mouse Soluble Tumor Necrosis Factor-Related Apoptosis Inducing Ligand ELISA Kit
MBS045464-02 96 Well

Mouse Soluble Tumor Necrosis Factor-Related Apoptosis Inducing Ligand ELISA Kit

Sign In for Pricing
View Details
Mouse Soluble Tumor Necrosis Factor-Related Apoptosis Inducing Ligand ELISA Kit
MBS045464-03 5x 96 Well

Mouse Soluble Tumor Necrosis Factor-Related Apoptosis Inducing Ligand ELISA Kit

Sign In for Pricing
View Details
Mouse Soluble Tumor Necrosis Factor-Related Apoptosis Inducing Ligand ELISA Kit
MBS045464-04 10x 96 Well

Mouse Soluble Tumor Necrosis Factor-Related Apoptosis Inducing Ligand ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CDCA4 Protein, N-His-SUMO
orb2833611-01 20 µg

Recombinant Human CDCA4 Protein, N-His-SUMO

Sign In for Pricing
View Details