Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp1b2 Rabbit Polyclonal Antibody (FITC)

Atp1b2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Am, Amog, Atpb, Atpb-2

UniProt

P14231

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038201

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HSP20/HSPB6 Antibody (6A4)
H00126393-M03 0.1 mg

Mouse Monoclonal HSP20/HSPB6 Antibody (6A4)

Sign In for Pricing
View Details
Rabbit anti-PHF6 Antibody, Affinity Purified
A301-450A-T 2 µg

Rabbit anti-PHF6 Antibody, Affinity Purified

Sign In for Pricing
View Details
Mouse very low density lipoprotein (VLDL) ELISA Kit
MBS8822501-01 48 Well

Mouse very low density lipoprotein (VLDL) ELISA Kit

Sign In for Pricing
View Details
Mouse very low density lipoprotein (VLDL) ELISA Kit
MBS8822501-02 96 Well

Mouse very low density lipoprotein (VLDL) ELISA Kit

Sign In for Pricing
View Details
Mouse very low density lipoprotein (VLDL) ELISA Kit
MBS8822501-03 5x 96 Well

Mouse very low density lipoprotein (VLDL) ELISA Kit

Sign In for Pricing
View Details
Mouse very low density lipoprotein (VLDL) ELISA Kit
MBS8822501-04 10x 96 Well

Mouse very low density lipoprotein (VLDL) ELISA Kit

Sign In for Pricing
View Details