Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH8 Rabbit Polyclonal Antibody (FITC)

CDH8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Nbla04261

UniProt

P55286

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human CDH8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLHTDLDPGSKKIKYILSGDGAGTIFQINDVTGDIHAIKRLDREEKAEYT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001787.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-mouse/human/rat CD47 (IAP) -InVivo
A2140-5mg 5 mg

Anti-mouse/human/rat CD47 (IAP) -InVivo

Sign In for Pricing
View Details
Lentiviral mouse Lad1 shRNA (UAS) - Lentiviral mouse Lad1 shRNA (UAS, GFP) plasmid
GTR15296749 1 Vial

Lentiviral mouse Lad1 shRNA (UAS) - Lentiviral mouse Lad1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Ccdc89 (Coiled-coil Domain-Containing Protein 89, Bc8 orange-interacting Protein, Ccdc89) (MaxLight 750)
MBS6454873-01 0.1 mL

Ccdc89 (Coiled-coil Domain-Containing Protein 89, Bc8 orange-interacting Protein, Ccdc89) (MaxLight 750)

Sign In for Pricing
View Details
Ccdc89 (Coiled-coil Domain-Containing Protein 89, Bc8 orange-interacting Protein, Ccdc89) (MaxLight 750)
MBS6454873-02 5x 0.1 mL

Ccdc89 (Coiled-coil Domain-Containing Protein 89, Bc8 orange-interacting Protein, Ccdc89) (MaxLight 750)

Sign In for Pricing
View Details
MAP3K13, CT (S869) (MAP3K13, LZK, Mitogen-activated protein kinase kinase kinase 13, Leucine zipper-bearing kinase, Mixed lineage kinase) (Azide free) (HRP) discontinued
038142-HRP 200 µL

MAP3K13, CT (S869) (MAP3K13, LZK, Mitogen-activated protein kinase kinase kinase 13, Leucine zipper-bearing kinase, Mixed lineage kinase) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Rasal1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3854207 1.0 µg DNA

Rasal1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details