Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dct Rabbit Polyclonal Antibody (Biotin)

Dct Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DT, TR, TRP, Tyr, slt, TRP2, Tyrp, TRP-2, Tyrp2, slaty, Tyrp-2

UniProt

P29812

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CPPLGPEATNICGFLEGRGQCAEVQTDTRPWSGPYILRNQDDREQWPRKF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHB16 CRISPR All-in-one AAV vector set (with saCas9)(Human)
36146151 3x 1.0 µg DNA

PCDHB16 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Kisspeptin Receptor (KISS1R) Magnetic Fluorescence Assay Kit
MBS2160171-01 96 Tests

Kisspeptin Receptor (KISS1R) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Kisspeptin Receptor (KISS1R) Magnetic Fluorescence Assay Kit
MBS2160171-02 5x 96 Tests

Kisspeptin Receptor (KISS1R) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Kisspeptin Receptor (KISS1R) Magnetic Fluorescence Assay Kit
MBS2160171-03 10x 96 Tests

Kisspeptin Receptor (KISS1R) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Recombinant Human RBM5 Protein - (Dry Ice)
H00010181-P01-25ug 25 µg

Recombinant Human RBM5 Protein - (Dry Ice)

Sign In for Pricing
View Details
Taz sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4115407 1.0 µg DNA

Taz sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details