Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dct Rabbit Polyclonal Antibody (HRP)

Dct Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DT, TR, TRP, Tyr, slt, TRP2, Tyrp, TRP-2, Tyrp2, slaty, Tyrp-2

UniProt

P29812

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CPPLGPEATNICGFLEGRGQCAEVQTDTRPWSGPYILRNQDDREQWPRKF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD116-12 AAV siRNA Pooled Vector
44782161 1.0 µg

SNORD116-12 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
JOSD2 Rabbit Polyclonal Antibody (Biotin)
orb2109061 100 µL

JOSD2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Golimumab (Anti-TNFSF2 / TNFa)
C00638-1mg 1 mg

Golimumab (Anti-TNFSF2 / TNFa)

Sign In for Pricing
View Details
NAPSIN A Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61759R-BF647 100 µL

NAPSIN A Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Mevonlerbart Monoclonal Antibody
orb2977140-01 100 µg

Mevonlerbart Monoclonal Antibody

Sign In for Pricing
View Details
Mevonlerbart Monoclonal Antibody
orb2977140-02 1 mg

Mevonlerbart Monoclonal Antibody

Sign In for Pricing
View Details