Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dct Rabbit Polyclonal Antibody (HRP)

Dct Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DT, TR, TRP, Tyr, slt, TRP2, Tyrp, TRP-2, Tyrp2, slaty, Tyrp-2

UniProt

P29812

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CPPLGPEATNICGFLEGRGQCAEVQTDTRPWSGPYILRNQDDREQWPRKF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIC5 (Chloride intracellular channel protein 5) (APC) discontinued
030877-APC 200 µL

CLIC5 (Chloride intracellular channel protein 5) (APC) discontinued

Sign In for Pricing
View Details
BRDU antibody (Prediluted for IHC)
75R-1006 7 ml

BRDU antibody (Prediluted for IHC)

Sign In for Pricing
View Details
Iron-sulfur cluster assembly 1 homolog mitochondrial (ISCA1) Bovine ELISA Kit
E4446 96 Tests

Iron-sulfur cluster assembly 1 homolog mitochondrial (ISCA1) Bovine ELISA Kit

Sign In for Pricing
View Details
Recombinant Human AMPK (G1/B1/A2) Heterotrimer Protein
MBS2545012-01 0.05 mg

Recombinant Human AMPK (G1/B1/A2) Heterotrimer Protein

Sign In for Pricing
View Details
Recombinant Human AMPK (G1/B1/A2) Heterotrimer Protein
MBS2545012-02 5x 0.05 mg

Recombinant Human AMPK (G1/B1/A2) Heterotrimer Protein

Sign In for Pricing
View Details
Mouse Monoclonal Brorin/VWC2 Antibody (03)
NBP3-05796-100ul 100 µL

Mouse Monoclonal Brorin/VWC2 Antibody (03)

Sign In for Pricing
View Details