Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dct Rabbit Polyclonal Antibody (FITC)

Dct Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DT, TR, TRP, Tyr, slt, TRP2, Tyrp, TRP-2, Tyrp2, slaty, Tyrp-2

UniProt

Q6NXI2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QHWLGLLGPNGTQPQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKAIDFS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_034154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue, Total Protein, Human Disease, Diabetes, Small Intestine, Ileum HisTekTM
T5595-6650N 1 mg

Tissue, Total Protein, Human Disease, Diabetes, Small Intestine, Ileum HisTekTM

Sign In for Pricing
View Details
Mouse Monoclonal Mannose Phosphate Isomerase Antibody (OTI1C7) [DyLight 550]
NBP2-72582R 0.1 mL

Mouse Monoclonal Mannose Phosphate Isomerase Antibody (OTI1C7) [DyLight 550]

Sign In for Pricing
View Details
CBV1 Mature virion in complex Antibody, InVivo Block/Neutralizing Antibody
ANT-37197-100ug 100 µg

CBV1 Mature virion in complex Antibody, InVivo Block/Neutralizing Antibody

Sign In for Pricing
View Details
Bcl-2 Recombinant Rabbit Monoclonal Antibody
orb2563019-01 25 µL

Bcl-2 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Bcl-2 Recombinant Rabbit Monoclonal Antibody
orb2563019-02 50 µL

Bcl-2 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Bcl-2 Recombinant Rabbit Monoclonal Antibody
orb2563019-03 100 µL

Bcl-2 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details