Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GZMK Rabbit Polyclonal Antibody (HRP)

GZMK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRYP2

UniProt

P49863

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GZMK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_002095

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PURA (purine-rich element binding protein A, PUR1, PURALPHA, PUR-ALPHA, Purine-rich single-stranded DNA-binding protein alpha, Transcriptional activator protein Pur-alpha) (AP) discontinued
P9600-95-AP 100 µL

PURA (purine-rich element binding protein A, PUR1, PURALPHA, PUR-ALPHA, Purine-rich single-stranded DNA-binding protein alpha, Transcriptional activator protein Pur-alpha) (AP) discontinued

Sign In for Pricing
View Details
Gr-1 (GR1, Myeloid Differentiation Antigen, Lymphocyte Antigen 6 Complex Locus G, Lymphocyte Antigen 6G, Ly6g, Ly-6G, Ly-6G.1) (FITC)
G8750-02F-FITC 100 µL

Gr-1 (GR1, Myeloid Differentiation Antigen, Lymphocyte Antigen 6 Complex Locus G, Lymphocyte Antigen 6G, Ly6g, Ly-6G, Ly-6G.1) (FITC)

Sign In for Pricing
View Details
Recombinant Human IL12 Protein, His-tagged
IL12-12H 10 µg

Recombinant Human IL12 Protein, His-tagged

Sign In for Pricing
View Details
Recombinant Plasmodium vivax NAD (P)H-hydrate epimerase
MBS1261827-01 0.02 mg (E-Coli)

Recombinant Plasmodium vivax NAD (P)H-hydrate epimerase

Sign In for Pricing
View Details
Recombinant Plasmodium vivax NAD (P)H-hydrate epimerase
MBS1261827-02 0.02 mg (Yeast)

Recombinant Plasmodium vivax NAD (P)H-hydrate epimerase

Sign In for Pricing
View Details
Recombinant Plasmodium vivax NAD (P)H-hydrate epimerase
MBS1261827-03 0.1 mg (E-Coli)

Recombinant Plasmodium vivax NAD (P)H-hydrate epimerase

Sign In for Pricing
View Details