Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Itih1 Rabbit Polyclonal Antibody (HRP)

Itih1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

In, Itih, Intin1, Itih-1, ITI-HC1

UniProt

Q61702

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGFGHDLDFSFLEVMSTENNGWAQRIYEDHDATQQLQGFYNQVANPLLTD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

101kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032432

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit
MBS2021867-01 24 Strip Well

Human Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit

Sign In for Pricing
View Details
Human Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit
MBS2021867-02 48 Well

Human Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit

Sign In for Pricing
View Details
Human Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit
MBS2021867-03 96 Well

Human Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit

Sign In for Pricing
View Details
Human Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit
MBS2021867-04 5x 96 Well

Human Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit

Sign In for Pricing
View Details
Human Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit
MBS2021867-05 10x 96 Well

Human Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit

Sign In for Pricing
View Details
Anti-PE CD361 (Rabbit, Monoclonal)
A118624 100 µL

Anti-PE CD361 (Rabbit, Monoclonal)

Sign In for Pricing
View Details