Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRCH4 Rabbit Polyclonal Antibody (Biotin)

LRCH4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LRN, LRRN1, LRRN4, PP14183

UniProt

O75427

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LRCH4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002310

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU6-28 Recombinant Protein (Human)
RP089073 100 µg

RNU6-28 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-Aconitase 2 Rabbit Monoclonal Antibody
MA1068-.1 100 µL

Anti-Aconitase 2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Siglec 10, CT (Siglec 10, SLG2, Sialic acid-binding Ig-like lectin 10, Siglec like protein 2) (Biotin)
MBS6347584-01 0.2 mL

Siglec 10, CT (Siglec 10, SLG2, Sialic acid-binding Ig-like lectin 10, Siglec like protein 2) (Biotin)

Sign In for Pricing
View Details
Siglec 10, CT (Siglec 10, SLG2, Sialic acid-binding Ig-like lectin 10, Siglec like protein 2) (Biotin)
MBS6347584-02 5x 0.2 mL

Siglec 10, CT (Siglec 10, SLG2, Sialic acid-binding Ig-like lectin 10, Siglec like protein 2) (Biotin)

Sign In for Pricing
View Details
TFF3 Polyclonal Antibody
orb3150916-01 50 µg

TFF3 Polyclonal Antibody

Sign In for Pricing
View Details
TFF3 Polyclonal Antibody
orb3150916-02 100 µg

TFF3 Polyclonal Antibody

Sign In for Pricing
View Details