Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRPAP1 Rabbit Polyclonal Antibody (HRP)

LRPAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAP, MRAP, A2RAP, HBP44, MYP23, A2MRAP, alpha-2-MRAP

UniProt

P30533

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LRPAP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRH

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002328

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ADGRE5 Antibody Picoband® (Dylight488 Conjugate)
A30392-2-Dylight488 100 µg

Anti-ADGRE5 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Monoclonal Antibody to mNoxa (Clone: ABM46B8)
MBS668433-01 0.025 mg

Monoclonal Antibody to mNoxa (Clone: ABM46B8)

Sign In for Pricing
View Details
Monoclonal Antibody to mNoxa (Clone: ABM46B8)
MBS668433-02 0.1 mg

Monoclonal Antibody to mNoxa (Clone: ABM46B8)

Sign In for Pricing
View Details
Monoclonal Antibody to mNoxa (Clone: ABM46B8)
MBS668433-03 5x 0.1 mg

Monoclonal Antibody to mNoxa (Clone: ABM46B8)

Sign In for Pricing
View Details
Anti-CTNNBIP1  (5C6)
YF-MA19003 100 ug

Anti-CTNNBIP1 (5C6)

Sign In for Pricing
View Details
TNFSF10 (Tumor Necrosis Factor Ligand Superfamily Member 10, Apo-2 Ligand, Apo-2L, APO2L, CD253, TNF-related Apoptosis-inducing Ligand, Protein TRAIL, TRAIL, TL2) (MaxLight 490)
134546-ML490 100 µL

TNFSF10 (Tumor Necrosis Factor Ligand Superfamily Member 10, Apo-2 Ligand, Apo-2L, APO2L, CD253, TNF-related Apoptosis-inducing Ligand, Protein TRAIL, TRAIL, TL2) (MaxLight 490)

Sign In for Pricing
View Details