Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGST2 Rabbit Polyclonal Antibody (HRP)

MGST2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GST2, MGST-II

UniProt

Q99735

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MGST2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002404

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti Chitobioside Antibody ELISA Kit
MBS7279357-01 48 Well

Mouse Anti Chitobioside Antibody ELISA Kit

Sign In for Pricing
View Details
Mouse Anti Chitobioside Antibody ELISA Kit
MBS7279357-02 96 Well

Mouse Anti Chitobioside Antibody ELISA Kit

Sign In for Pricing
View Details
Mouse Anti Chitobioside Antibody ELISA Kit
MBS7279357-03 5x 96 Well

Mouse Anti Chitobioside Antibody ELISA Kit

Sign In for Pricing
View Details
Mouse Anti Chitobioside Antibody ELISA Kit
MBS7279357-04 10x 96 Well

Mouse Anti Chitobioside Antibody ELISA Kit

Sign In for Pricing
View Details
CD122 (CD122 Antigen, High Affinity IL-2 Receptor Subunit beta, Interleukin 2 Receptor beta, Interleukin-2 Receptor Subunit beta, IL-2 Receptor Subunit beta, IL-2R Subunit beta, IL2RB, IL-2RB, IL15RB, p70-75, p75) (MaxLight 650)
MBS6372770-01 0.1 mL

CD122 (CD122 Antigen, High Affinity IL-2 Receptor Subunit beta, Interleukin 2 Receptor beta, Interleukin-2 Receptor Subunit beta, IL-2 Receptor Subunit beta, IL-2R Subunit beta, IL2RB, IL-2RB, IL15RB, p70-75, p75) (MaxLight 650)

Sign In for Pricing
View Details
CD122 (CD122 Antigen, High Affinity IL-2 Receptor Subunit beta, Interleukin 2 Receptor beta, Interleukin-2 Receptor Subunit beta, IL-2 Receptor Subunit beta, IL-2R Subunit beta, IL2RB, IL-2RB, IL15RB, p70-75, p75) (MaxLight 650)
MBS6372770-02 5x 0.1 mL

CD122 (CD122 Antigen, High Affinity IL-2 Receptor Subunit beta, Interleukin 2 Receptor beta, Interleukin-2 Receptor Subunit beta, IL-2 Receptor Subunit beta, IL-2R Subunit beta, IL2RB, IL-2RB, IL15RB, p70-75, p75) (MaxLight 650)

Sign In for Pricing
View Details