Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMG Rabbit Polyclonal Antibody (FITC)

OMG Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OMGP

UniProt

P23515

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OMG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002535

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-STRBP antibody
STJ117363 100 µl

Anti-STRBP antibody

Sign In for Pricing
View Details
SUMO2, SUMO3, NT (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (Biotin) discontinued
S8026-01E-Biotin 200 µL

SUMO2, SUMO3, NT (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (Biotin) discontinued

Sign In for Pricing
View Details
2- (benzylamino) -5,6,7,8-tetrahydro[1]benzothieno[2,3-d]pyrimidin-4 (3H) -one
sc-273948 250 mg

2- (benzylamino) -5,6,7,8-tetrahydro[1]benzothieno[2,3-d]pyrimidin-4 (3H) -one

Sign In for Pricing
View Details
Recombinant Salmonella arizonae Outer-membrane lipoprotein lolB (lolB)
MBS1124839-01 0.02 mg (E-Coli)

Recombinant Salmonella arizonae Outer-membrane lipoprotein lolB (lolB)

Sign In for Pricing
View Details
Recombinant Salmonella arizonae Outer-membrane lipoprotein lolB (lolB)
MBS1124839-02 0.1 mg (E-Coli)

Recombinant Salmonella arizonae Outer-membrane lipoprotein lolB (lolB)

Sign In for Pricing
View Details
Recombinant Salmonella arizonae Outer-membrane lipoprotein lolB (lolB)
MBS1124839-03 0.02 mg (Yeast)

Recombinant Salmonella arizonae Outer-membrane lipoprotein lolB (lolB)

Sign In for Pricing
View Details