Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMG Rabbit Polyclonal Antibody (FITC)

OMG Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OMGP

UniProt

P23515

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OMG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002535

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken REG1alpha (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit
MBS2511415-01 24 Tests

Chicken REG1alpha (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Chicken REG1alpha (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit
MBS2511415-02 48 Tests

Chicken REG1alpha (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Chicken REG1alpha (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit
MBS2511415-03 96 Tests

Chicken REG1alpha (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Chicken REG1alpha (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit
MBS2511415-04 5x 96 Tests

Chicken REG1alpha (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Chicken REG1alpha (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit
MBS2511415-05 10x 96 Tests

Chicken REG1alpha (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Recombinant Nostoc sp. Glycerol-3-phosphate acyltransferase (plsY)
MBS7026574-01 0.02 mg

Recombinant Nostoc sp. Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details