Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDH8 Rabbit Polyclonal Antibody (Biotin)

PCDH8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PAPC, ARCADLIN

UniProt

Q5TAN1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCDH8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

101kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116567

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vmn2r123 shRNA (UAS) - Lentiviral mouse Vmn2r123 shRNA (UAS, iRFP) (25)
GTR15192146 1 Vial

Lentiviral mouse Vmn2r123 shRNA (UAS) - Lentiviral mouse Vmn2r123 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Factor H (Complement Factor H, CFH, CFHL3, ARMD4, ARMS1, FH, H Factor 1, HF1, HF, HF2, HUS, MGC88246) (AP)
MBS6247915-01 0.1 mL

Factor H (Complement Factor H, CFH, CFHL3, ARMD4, ARMS1, FH, H Factor 1, HF1, HF, HF2, HUS, MGC88246) (AP)

Sign In for Pricing
View Details
Factor H (Complement Factor H, CFH, CFHL3, ARMD4, ARMS1, FH, H Factor 1, HF1, HF, HF2, HUS, MGC88246) (AP)
MBS6247915-02 5x 0.1 mL

Factor H (Complement Factor H, CFH, CFHL3, ARMD4, ARMS1, FH, H Factor 1, HF1, HF, HF2, HUS, MGC88246) (AP)

Sign In for Pricing
View Details
Ms4a15 3'UTR GFP Stable Cell Line
TU263467 1.0 mL

Ms4a15 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TCEB2 Protein Vector (Mouse) (pPM-C-HA)
PV237016 500 ng

TCEB2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ACAP1, NT (ACAP1, CENTB1, KIAA0050, Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1, Centaurin-beta-1) (FITC) discontinued
031520-FITC 200 µL

ACAP1, NT (ACAP1, CENTB1, KIAA0050, Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1, Centaurin-beta-1) (FITC) discontinued

Sign In for Pricing
View Details