Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLP2 Rabbit Polyclonal Antibody (HRP)

PLP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A4, A4LSB

UniProt

Q04941

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PLP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002659

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4487 agomir
HY-R01096A-01 5 nmol

Hsa-miR-4487 agomir

Sign In for Pricing
View Details
Hsa-miR-4487 agomir
HY-R01096A-02 20 nmol

Hsa-miR-4487 agomir

Sign In for Pricing
View Details
Lentiviral human LRRC17 shRNA (UAS) - Lentiviral human LRRC17 shRNA (UAS) plasmid
GTR15322138 1 Vial

Lentiviral human LRRC17 shRNA (UAS) - Lentiviral human LRRC17 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Glutamate carboxypeptidase 2 (FOLH1) Porcine ELISA Kit
D7210 96 Tests

Glutamate carboxypeptidase 2 (FOLH1) Porcine ELISA Kit

Sign In for Pricing
View Details
Lentiviral human SAMD15 shRNA (UAS) - Lentiviral human SAMD15 shRNA (UAS, GFP) (25)
GTR15337067 1 Vial

Lentiviral human SAMD15 shRNA (UAS) - Lentiviral human SAMD15 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Corning CellBIND Surface HYPERFlask M Culture Vessel Treated St.Bar Code
10020-01 4 / PCK

Corning CellBIND Surface HYPERFlask M Culture Vessel Treated St.Bar Code

Sign In for Pricing
View Details