Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mfng Rabbit Polyclonal Antibody (HRP)

Mfng Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AW546563

UniProt

O09008

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CKLGGRLQPSPLFHSHLETLQLLGAAQLPEQVTLSYGVFEGKLNVIKLPG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032621

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr150 (NM_175495) Mouse Tagged ORF Clone
MG219905 10 µg

Gpr150 (NM_175495) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RREB1 (NM_001003699) Human Over-expression Lysate
LH03391V 100 µg

RREB1 (NM_001003699) Human Over-expression Lysate

Sign In for Pricing
View Details
CD105 (ENG) Mouse Monoclonal Antibody [Clone 3H5]
E45M13714V-2 50 µL

CD105 (ENG) Mouse Monoclonal Antibody [Clone 3H5]

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ficolin 1 (FCN1)
MBS2047420-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Ficolin 1 (FCN1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ficolin 1 (FCN1)
MBS2047420-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Ficolin 1 (FCN1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ficolin 1 (FCN1)
MBS2047420-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Ficolin 1 (FCN1)

Sign In for Pricing
View Details