Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST3GAL1 Rabbit Polyclonal Antibody (HRP)

ST3GAL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ST3O, SIAT4A, SIATFL, ST3GalA, ST3GalIA, Gal-NAc6S, ST3GalA.1, ST3GalIA,1

UniProt

Q11201

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ST3GAL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003024

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P38 MAPK (Ab-180) Antibody
8B7178-AAT 50 µg

P38 MAPK (Ab-180) Antibody

Sign In for Pricing
View Details
Flufenacet ESA Sodium Salt
TRC-F599428-50MG 50 mg

Flufenacet ESA Sodium Salt

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS802901 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS808196 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
CGBP (CXXC1) Rabbit Polyclonal Antibody
TA375256 100 µL

CGBP (CXXC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Arachidonic Acid Glycidyl Ester
TRC-A765060-50MG 50 mg

Arachidonic Acid Glycidyl Ester

Sign In for Pricing
View Details