Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFB2 Rabbit Polyclonal Antibody (HRP)

TGFB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LDS4, G-TSF, TGF-beta2

UniProt

P61812

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TGFB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hypoxia Inducible Factor 1 Alpha (HIF1a) ELISA Kit
RD-HIF1a-Mu-48Tests 48 Tests

Mouse Hypoxia Inducible Factor 1 Alpha (HIF1a) ELISA Kit

Sign In for Pricing
View Details
Tank sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
46114116 3x 1.0 µg

Tank sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
N, N-bis (2,2-dimethoxyethyl) nitrous amide
CS-O-58609 1 Each

N, N-bis (2,2-dimethoxyethyl) nitrous amide

Sign In for Pricing
View Details
Recombinant Human HDAC10 Protein
E30P4542 20 µg

Recombinant Human HDAC10 Protein

Sign In for Pricing
View Details
TRAPPC6A-set siRNA/shRNA/RNAi Lentivector (Human)
47531091 4x 500 ng

TRAPPC6A-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Recombinant Human Calnexin/CANX protein (His tag)
PDMH100389-01 20 µg

Recombinant Human Calnexin/CANX protein (His tag)

Sign In for Pricing
View Details