Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFB2 Rabbit Polyclonal Antibody (HRP)

TGFB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LDS4, G-TSF, TGF-beta2

UniProt

P61812

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TGFB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGTR2 Protein Vector (Human) (pPM-C-His)
PV061552 500 ng

AGTR2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Adolase A Kinase, monoclonal antibody, mouse
MBS555682-01 0.1 mL

Adolase A Kinase, monoclonal antibody, mouse

Sign In for Pricing
View Details
Adolase A Kinase, monoclonal antibody, mouse
MBS555682-02 5x 0.1 mL

Adolase A Kinase, monoclonal antibody, mouse

Sign In for Pricing
View Details
WDYHV1 Antibody, HRP conjugated
MBS1492140-01 0.05 mg

WDYHV1 Antibody, HRP conjugated

Sign In for Pricing
View Details
WDYHV1 Antibody, HRP conjugated
MBS1492140-02 0.1 mg

WDYHV1 Antibody, HRP conjugated

Sign In for Pricing
View Details
WDYHV1 Antibody, HRP conjugated
MBS1492140-03 5x 0.1 mg

WDYHV1 Antibody, HRP conjugated

Sign In for Pricing
View Details