Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN6 Rabbit Polyclonal Antibody (FITC)

TSPAN6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

T245, TM4SF6, TSPAN-6

UniProt

O43657

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TSPAN6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003261

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine cardiac isoform of Troponin T(cTnT) ELISA Kit
MBS2609008-01 48 Well

Bovine cardiac isoform of Troponin T(cTnT) ELISA Kit

Sign In for Pricing
View Details
Bovine cardiac isoform of Troponin T(cTnT) ELISA Kit
MBS2609008-02 96 Well

Bovine cardiac isoform of Troponin T(cTnT) ELISA Kit

Sign In for Pricing
View Details
Bovine cardiac isoform of Troponin T(cTnT) ELISA Kit
MBS2609008-03 5x 96 Well

Bovine cardiac isoform of Troponin T(cTnT) ELISA Kit

Sign In for Pricing
View Details
Bovine cardiac isoform of Troponin T(cTnT) ELISA Kit
MBS2609008-04 10x 96 Well

Bovine cardiac isoform of Troponin T(cTnT) ELISA Kit

Sign In for Pricing
View Details
MCP-3/CCL7 Protein, Human, Recombinant (CHO)
TMPS-00101-01 5 µg

MCP-3/CCL7 Protein, Human, Recombinant (CHO)

Sign In for Pricing
View Details
MCP-3/CCL7 Protein, Human, Recombinant (CHO)
TMPS-00101-02 10 µg

MCP-3/CCL7 Protein, Human, Recombinant (CHO)

Sign In for Pricing
View Details