Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN6 Rabbit Polyclonal Antibody (HRP)

TSPAN6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

T245, TM4SF6, TSPAN-6

UniProt

O43657

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TSPAN6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003261

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Barium laurate
B00178 100 g

Barium laurate

Sign In for Pricing
View Details
Lentiviral mouse Pus3 shRNA (UAS) - Lentiviral mouse Pus3 shRNA (UAS, GFP) plasmid
GTR15191410 1 Vial

Lentiviral mouse Pus3 shRNA (UAS) - Lentiviral mouse Pus3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Runx2 (NM_001145920) Mouse Tagged ORF Clone Lentiviral Particle
MR227541L4V 200 µL

Runx2 (NM_001145920) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KREMEN2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1164704 1.0 µg DNA

KREMEN2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
OR5B12, CT (OR5B12, OR5B12P, OR5B16, Olfactory receptor 5B12, Olfactory receptor 5B16, Olfactory receptor OR11-241) (MaxLight 650)
MBS6329215-01 0.1 mL

OR5B12, CT (OR5B12, OR5B12P, OR5B16, Olfactory receptor 5B12, Olfactory receptor 5B16, Olfactory receptor OR11-241) (MaxLight 650)

Sign In for Pricing
View Details
OR5B12, CT (OR5B12, OR5B12P, OR5B16, Olfactory receptor 5B12, Olfactory receptor 5B16, Olfactory receptor OR11-241) (MaxLight 650)
MBS6329215-02 5x 0.1 mL

OR5B12, CT (OR5B12, OR5B12P, OR5B16, Olfactory receptor 5B12, Olfactory receptor 5B16, Olfactory receptor OR11-241) (MaxLight 650)

Sign In for Pricing
View Details