Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIP Rabbit Polyclonal Antibody (HRP)

VIP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHM27

UniProt

P01282

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human VIP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit
MBS3800983-01 48 Well

Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit

Sign In for Pricing
View Details
Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit
MBS3800983-02 96 Well

Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit

Sign In for Pricing
View Details
Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit
MBS3800983-03 5x 96 Well

Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit

Sign In for Pricing
View Details
Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit
MBS3800983-04 10x 96 Well

Human Cold-Inducible RNA-Binding Protein (CIRBP) ELISA Kit

Sign In for Pricing
View Details
Multiplex Assay Kit for Interleukin 18 Binding Protein (IL18BP), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031331 96 Tests

Multiplex Assay Kit for Interleukin 18 Binding Protein (IL18BP), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
3- (Benzyloxy) -5-bromo-2-fluoropyridine
PC1004565-01 100 mg

3- (Benzyloxy) -5-bromo-2-fluoropyridine

Sign In for Pricing
View Details