Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZP2 Rabbit Polyclonal Antibody (Biotin)

ZP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZPA, Zp-2, OOMD6

UniProt

Q05996

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003451

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SMYD4 activation kit by CRISPRa
GA114475 1 Kit

Human SMYD4 activation kit by CRISPRa

Sign In for Pricing
View Details
Col14a1 Mouse Gene Knockout Kit (CRISPR)
KN503618 1 Kit

Col14a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zfp688 Mouse Gene Knockout Kit (CRISPR)
KN519939 1 Kit

Zfp688 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR51B2 Human Gene Knockout Kit (CRISPR)
KN422213 1 Kit

OR51B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Uterus
CR559158 5 µg

Tissue Total RNA, Uterus

Sign In for Pricing
View Details
RGS12 Human Gene Knockout Kit (CRISPR)
KN423124 1 Kit

RGS12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details