Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED4, Human (HEK293, His)

The TMED4 protein is complexly involved in vesicular protein trafficking in the early secretory pathway, which is critical for targeting and maintenance of the Golgi apparatus. Its involvement extends to the biosynthesis of secretions, emphasizing its role in processing. TMED4 Protein, Human (HEK293, His) is the recombinant human-derived TMED4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TMED4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmed4-protein-human-hek293-his.html

Purity

96.00

Smiles

LYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQR

Molecular Formula

222068 (Gene_ID) Q7Z7H5-1 (L30-R194) (Accession)

Molecular Weight

Approximately 23-24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1031 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4185606 1.0 µg DNA

Olfr1031 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Nori® Sheep MMP-3 DyLight 488 Polyclonal Antibody
GR203049 50 µg

Nori® Sheep MMP-3 DyLight 488 Polyclonal Antibody

Sign In for Pricing
View Details
Human TMED7 Pre-designed siRNA Set B
SI016771B 1 Each

Human TMED7 Pre-designed siRNA Set B

Sign In for Pricing
View Details
AZD1390 25mg
A16798-25 25 mg

AZD1390 25mg

Sign In for Pricing
View Details
CD11c/ITGAX Human Monoclonal Antibody (PerCP)
orb2971930-01 50 Tests

CD11c/ITGAX Human Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details
CD11c/ITGAX Human Monoclonal Antibody (PerCP)
orb2971930-02 100 Tests

CD11c/ITGAX Human Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details