Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scg2 Rabbit Polyclonal Antibody (FITC)

Scg2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Chcg

UniProt

P10362

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DIDRPDMFQSKTLSKGGYPKAPGRGMMEALPDGLSVEDILNVLGMENVAN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_073160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 antibody
70R-13706 100 ug

CD71 antibody

Sign In for Pricing
View Details
RAB23 (NM_183227) Human Tagged Lenti ORF Clone
RC221508L2 10 µg

RAB23 (NM_183227) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OR7E83P Protein Vector (Human) (pPM-C-HA)
PV108724 500 ng

OR7E83P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TMEM41A Protein Vector (Human) (pPB-N-His)
PV042886 500 ng

TMEM41A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
OR1F1, CT (OR1F1, OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, Olfactory receptor 1F1, Olfactory receptor 16-35, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory
MBS6328189-01 0.1 mL

OR1F1, CT (OR1F1, OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, Olfactory receptor 1F1, Olfactory receptor 16-35, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory

Sign In for Pricing
View Details
OR1F1, CT (OR1F1, OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, Olfactory receptor 1F1, Olfactory receptor 16-35, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory
MBS6328189-02 5x 0.1 mL

OR1F1, CT (OR1F1, OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, Olfactory receptor 1F1, Olfactory receptor 16-35, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory

Sign In for Pricing
View Details