Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEGS1 Rabbit Polyclonal Antibody (FITC)

DEGS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MLD, DEGS, DES1, Des-1, FADS7, HLD18, MIG15, DEGS-1

UniProt

O15121

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DEGS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003667

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100b Rabbit Polyclonal Antibody
TA355639 100 µL

S100b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL1RL2 (Interleukin 1 Receptor-like 2, IL1R-rp2, IL1RRP2) (MaxLight 490)
247560-ML490 100 µL

IL1RL2 (Interleukin 1 Receptor-like 2, IL1R-rp2, IL1RRP2) (MaxLight 490)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to FMS Like Tyrosine Kinase 3 Ligand (Flt3L)
MBS2035713-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to FMS Like Tyrosine Kinase 3 Ligand (Flt3L)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to FMS Like Tyrosine Kinase 3 Ligand (Flt3L)
MBS2035713-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to FMS Like Tyrosine Kinase 3 Ligand (Flt3L)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to FMS Like Tyrosine Kinase 3 Ligand (Flt3L)
MBS2035713-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to FMS Like Tyrosine Kinase 3 Ligand (Flt3L)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to FMS Like Tyrosine Kinase 3 Ligand (Flt3L)
MBS2035713-04 1 mL

APC/CY7-Linked Polyclonal Antibody to FMS Like Tyrosine Kinase 3 Ligand (Flt3L)

Sign In for Pricing
View Details