Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC5C Rabbit Polyclonal Antibody (Biotin)

UNC5C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UNC5H3

UniProt

O95185

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human UNC5C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003719

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal Transducer and Activator of Transcription 5B Phospho-Ser731 (STAT5B pS731) DNA-Binding ELISA Kit
abx596647 96 Tests

Signal Transducer and Activator of Transcription 5B Phospho-Ser731 (STAT5B pS731) DNA-Binding ELISA Kit

Sign In for Pricing
View Details
Monkey Glutamate Receptor Interacting Protein 1 ELISA Kit
MBS104988-01 48 Well

Monkey Glutamate Receptor Interacting Protein 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Glutamate Receptor Interacting Protein 1 ELISA Kit
MBS104988-02 96 Well

Monkey Glutamate Receptor Interacting Protein 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Glutamate Receptor Interacting Protein 1 ELISA Kit
MBS104988-03 5x 96 Well

Monkey Glutamate Receptor Interacting Protein 1 ELISA Kit

Sign In for Pricing
View Details
Monkey Glutamate Receptor Interacting Protein 1 ELISA Kit
MBS104988-04 10x 96 Well

Monkey Glutamate Receptor Interacting Protein 1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human ZFHX4 Protein, N-His
orb3060815-01 50 µg

Recombinant Human ZFHX4 Protein, N-His

Sign In for Pricing
View Details