Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC5C Rabbit Polyclonal Antibody (HRP)

UNC5C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UNC5H3

UniProt

O95185

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human UNC5C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003719

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cenpe Mouse Pre-designed siRNA Set A
HY-RS02477 1 Set

Cenpe Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Pyruvate Carboxylase Activity Assay Kit (Colorimetric)
K2075-100 100 Assays

Pyruvate Carboxylase Activity Assay Kit (Colorimetric)

Sign In for Pricing
View Details
Zebrafish GMPS Rabbit Polyclonal Antibody (Fluoro550)
orb3090970 100 µg

Zebrafish GMPS Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Streptavidin-PE Conjugate in glyserol and 75 mg/mL BSA
SAPE-001G75 0.6 mg/mL

Streptavidin-PE Conjugate in glyserol and 75 mg/mL BSA

Sign In for Pricing
View Details
Inter Alpha-Globulin Inhibitor H1 (ITIH1), Recombinant, Rat, His-Tag, GST-Tag
049067-01 10 µg

Inter Alpha-Globulin Inhibitor H1 (ITIH1), Recombinant, Rat, His-Tag, GST-Tag

Sign In for Pricing
View Details
Inter Alpha-Globulin Inhibitor H1 (ITIH1), Recombinant, Rat, His-Tag, GST-Tag
049067-02 50 µg

Inter Alpha-Globulin Inhibitor H1 (ITIH1), Recombinant, Rat, His-Tag, GST-Tag

Sign In for Pricing
View Details