Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTCH2 Rabbit Polyclonal Antibody (HRP)

PTCH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PTC2

UniProt

Q9Y6C5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PTCH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

130kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003729

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CADM1 Antibody (N-term) Blocking peptide
MBS9217803-01 0.5 mg

CADM1 Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
CADM1 Antibody (N-term) Blocking peptide
MBS9217803-02 5x 0.5 mg

CADM1 Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
ELISA kit for Human Protein diaphanous homolog 2 (DIAPH2)
KTE62060-01 48 Tests

ELISA kit for Human Protein diaphanous homolog 2 (DIAPH2)

Sign In for Pricing
View Details
ELISA kit for Human Protein diaphanous homolog 2 (DIAPH2)
KTE62060-02 96 Tests

ELISA kit for Human Protein diaphanous homolog 2 (DIAPH2)

Sign In for Pricing
View Details
ELISA kit for Human Protein diaphanous homolog 2 (DIAPH2)
KTE62060-03 5x 96 Well

ELISA kit for Human Protein diaphanous homolog 2 (DIAPH2)

Sign In for Pricing
View Details
Polyclonal Antibody to STAT5A (Phospho-Ser780)
35-1048-100 100 µL

Polyclonal Antibody to STAT5A (Phospho-Ser780)

Sign In for Pricing
View Details