Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3galt2 Rabbit Polyclonal Antibody (HRP)

B3galt2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O54905

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_064409

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFYA Human siRNA Oligo Duplex (Locus ID 4800)
SR303170 1 Kit

NFYA Human siRNA Oligo Duplex (Locus ID 4800)

Sign In for Pricing
View Details
Bovine Endothelin converting enzyme 1 ELISA Kit
OM621478 96 Strip Well

Bovine Endothelin converting enzyme 1 ELISA Kit

Sign In for Pricing
View Details
RHOC CRISPR All-in-one AAV vector set (with saCas9)(Rat)
39515156 3x 1.0 µg DNA

RHOC CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
MFluor™ Violet 510 Anti-human CD16 Antibody *3G8*
10161110-AAT 100 Tests

MFluor™ Violet 510 Anti-human CD16 Antibody *3G8*

Sign In for Pricing
View Details
Anti-IkB alpha Antibody, Rabbit Polyclonal
MBS8106119-01 0.1 mL

Anti-IkB alpha Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-IkB alpha Antibody, Rabbit Polyclonal
MBS8106119-02 5x 0.1 mL

Anti-IkB alpha Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details