Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMD4 Rabbit Polyclonal Antibody (HRP)

TIMD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIM4, SMUCKLER

UniProt

Q96H15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001140198

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Siglec-8 V-set, His Tag
PL11-100 100 µg

Recombinant Human Siglec-8 V-set, His Tag

Sign In for Pricing
View Details
Mouse Anti-S100 Calcium Binding Protein B Antibody ELISA Kit
MBS7276382-01 48 Well

Mouse Anti-S100 Calcium Binding Protein B Antibody ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-S100 Calcium Binding Protein B Antibody ELISA Kit
MBS7276382-02 96 Well

Mouse Anti-S100 Calcium Binding Protein B Antibody ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-S100 Calcium Binding Protein B Antibody ELISA Kit
MBS7276382-03 5x 96 Well

Mouse Anti-S100 Calcium Binding Protein B Antibody ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-S100 Calcium Binding Protein B Antibody ELISA Kit
MBS7276382-04 10x 96 Well

Mouse Anti-S100 Calcium Binding Protein B Antibody ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Fam219b shRNA (UAS) - Lentiviral mouse Fam219b shRNA (UAS, RFP) (25)
GTR15207431 1 Vial

Lentiviral mouse Fam219b shRNA (UAS) - Lentiviral mouse Fam219b shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details