Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUC12 Rabbit Polyclonal Antibody (Biotin)

MUC12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MUC11, MUC-11, MUC-12

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MUC12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_499351

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC23L siRNA (Mouse)
orb1839756-01 15 nmol

TTC23L siRNA (Mouse)

Sign In for Pricing
View Details
TTC23L siRNA (Mouse)
orb1839756-02 30 nmol

TTC23L siRNA (Mouse)

Sign In for Pricing
View Details
ImmunoglobuLin J chain (23-159, His-tag) Human Protein
AR50863PU-S 100 µg

ImmunoglobuLin J chain (23-159, His-tag) Human Protein

Sign In for Pricing
View Details
Atp5e Mouse shRNA Lentiviral Particle (Locus ID 67126)
TL519314V 500 µL Each

Atp5e Mouse shRNA Lentiviral Particle (Locus ID 67126)

Sign In for Pricing
View Details
FICD (Adenosine Monophosphate-protein Transferase FICD, AMPylator FICD, FIC Domain-containing Protein, Huntingtin Yeast Partner E, Huntingtin-interacting Protein 13, HIP-13, Huntingtin-interacting Protein E, HIP13, HYPE, UNQ3041/PRO9857) (MaxLight 490)
126820-ML490 100 µL

FICD (Adenosine Monophosphate-protein Transferase FICD, AMPylator FICD, FIC Domain-containing Protein, Huntingtin Yeast Partner E, Huntingtin-interacting Protein 13, HIP-13, Huntingtin-interacting Protein E, HIP13, HYPE, UNQ3041/PRO9857) (MaxLight 490)

Sign In for Pricing
View Details
THOC7 Antibody
A68907-100UL 100 µL

THOC7 Antibody

Sign In for Pricing
View Details