Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF4A Rabbit Polyclonal Antibody (HRP)

HNF4A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TCF, HNF4, MODY, FRTS4, MODY1, NR2A1, TCF14, HNF4a7, HNF4a8, HNF4a9, NR2A21, HNF4alpha

UniProt

P41235

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HNF4A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001025174

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD55 Rabbit Polyclonal Antibody
TA313742 100 µL

CD55 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GLYAT (NM_201648) Human 3' UTR Clone
SC211868 10 µg

GLYAT (NM_201648) Human 3' UTR Clone

Sign In for Pricing
View Details
MAGE 1 (Antigen MZ2-E, MAGE1A, MAGEA1, Melanoma Antigen 1, Melanoma Associated Antigen MZ2-E, MGC9326)
MBS6507917-01 0.5 mL

MAGE 1 (Antigen MZ2-E, MAGE1A, MAGEA1, Melanoma Antigen 1, Melanoma Associated Antigen MZ2-E, MGC9326)

Sign In for Pricing
View Details
MAGE 1 (Antigen MZ2-E, MAGE1A, MAGEA1, Melanoma Antigen 1, Melanoma Associated Antigen MZ2-E, MGC9326)
MBS6507917-02 5x 0.5 mL

MAGE 1 (Antigen MZ2-E, MAGE1A, MAGEA1, Melanoma Antigen 1, Melanoma Associated Antigen MZ2-E, MGC9326)

Sign In for Pricing
View Details
Chicken Kisspeptin 1 (KISS1) ELISA Kit
MBS2612416-01 48 Well

Chicken Kisspeptin 1 (KISS1) ELISA Kit

Sign In for Pricing
View Details
Chicken Kisspeptin 1 (KISS1) ELISA Kit
MBS2612416-02 96 Well

Chicken Kisspeptin 1 (KISS1) ELISA Kit

Sign In for Pricing
View Details